PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK19051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 285aa    MW: 32927.4 Da    PI: 5.9429
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK19051.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.4e-50101381129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrF P+deelv++yL kk+ ++++    ++ e+d++++ePw+Lp  +k + +ewyfFs rd+kyatg r+nrat+ gyWkatgkd++v++  ++  
  PK19051.1  10 LPPGFRFYPSDEELVCHYLYKKICNEEILK-GTLVEIDLHTCEPWQLPDVAKLNASEWYFFSFRDRKYATGYRTNRATTCGYWKATGKDRTVVDPlTKDI 108
                79*************************877.78***************87777889**************************************988889 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                vg++ktLvfy++rap+g+kt W+mhe+rle
  PK19051.1 109 VGMRKTLVFYRNRAPNGVKTGWIMHEFRLE 138
                ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-608156IPR003441NAC domain
PROSITE profilePS5100556.9210156IPR003441NAC domain
PfamPF023651.7E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KICNEEILKG TLVEIDLHTC EPWQLPDVAK  60
LNASEWYFFS FRDRKYATGY RTNRATTCGY WKATGKDRTV VDPLTKDIVG MRKTLVFYRN  120
RAPNGVKTGW IMHEFRLETP HMPPKEDWVL CRVFHKSKES SSENMNNNIN QGINNSQQFN  180
HLSSISSSPP TIISDHHQQL RNLGNNNYDD DHDQIMINNI NHHDFSIINN NIIGTSITNV  240
NAATTTTEIS STTNDDYAFI WGINNNFNDD DQIREFDLEN SMVFX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-46916416171NO APICAL MERISTEM PROTEIN
1ut4_B1e-46916416171NO APICAL MERISTEM PROTEIN
1ut7_A1e-46916416171NO APICAL MERISTEM PROTEIN
1ut7_B1e-46916416171NO APICAL MERISTEM PROTEIN
3swm_A1e-46916419174NAC domain-containing protein 19
3swm_B1e-46916419174NAC domain-containing protein 19
3swm_C1e-46916419174NAC domain-containing protein 19
3swm_D1e-46916419174NAC domain-containing protein 19
3swp_A1e-46916419174NAC domain-containing protein 19
3swp_B1e-46916419174NAC domain-containing protein 19
3swp_C1e-46916419174NAC domain-containing protein 19
3swp_D1e-46916419174NAC domain-containing protein 19
4dul_A1e-46916416171NAC domain-containing protein 19
4dul_B1e-46916416171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050267.11e-121NAC domain protein, IPR003441
TrEMBLA0A061DNM91e-121A0A061DNM9_THECC; NAC domain protein, IPR003441
STRINGGLYMA19G34881.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-90NAC domain containing protein 74